Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SRI (Sorcin) for Antibody Discovery (CAT#: MP1295X)

This product is a 47.52 kDa Human SRI membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SRI
  • Protein Length
  • Full-length
  • Molecular Weight
  • 47.52 kDa
  • Sequence
  • MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Protein Format
  • Liposome
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SRI
  • Full Name
  • Sorcin
  • Introduction
  • This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene.
  • Alternative Names
  • SCN; V19; CP22; CP-22; sorcin; 22 kDa protein; H_RG167B05.1; calcium binding protein amplified in mutlidrug-resistant cells

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us