Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SSR1 (Signal sequence receptor subunit 1) Full Length (CAT#: MPC3972K) Made to Order

This product is a made-to-order Human SSR1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SSR1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDE
    DDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNI
    VKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR
    QATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIERE
    DGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQND
    VDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • SSR1
  • Full Name
  • Signal sequence receptor subunit 1
  • Introduction
  • The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • SSR1; TRAPA; translocon-associated protein subunit alpha; SSR alpha subunit; SSR-alpha; TRAP alpha; signal sequence receptor subunit alpha; signal sequence receptor, alpha; translocon-associated protein alpha subunit; Signal sequence receptor subunit 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us