Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ST14 (ST14 transmembrane serine protease matriptase) Expressed in E.coli for Antibody Discovery, Partial (596-855aa) (CAT#: MPX0192K)

This product is a 26 kDa Human ST14 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST14
  • Protein Length
  • Partial (596-855aa)
  • Protein Class
  • Protease
  • Molecular Weight
  • 26 kDa
  • TMD
  • 1
  • Sequence
  • GSDEK
    DCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNW
    LVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISH
    PFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGW
    GHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDS
    CQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIK
    ENTGV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris-HCl and Glycerol.

Target

  • Target Protein
  • ST14
  • Full Name
  • ST14 transmembrane serine protease matriptase
  • Introduction
  • The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
  • Alternative Names
  • ST14; HAI; CAP3; MTSP1; SNC19; ARCI11; MT-SP1; PRSS14; TADG15; TMPRSS14; suppressor of tumorigenicity 14 protein; channel-activating protein 3; membrane-type serine protease 1; prostamin; serine protease 14; serine protease TADG-15; suppression of tumorigenicity 14 (colon carcinoma); suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin); tumor associated differentially expressed gene 15 protein; ST14 transmembrane serine protease matriptase

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us