Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1) Full Length (CAT#: MPC4185K) Made to Order

This product is a made-to-order Human ST3GAL1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST3GAL1
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENL
    KRLIKHRPCTCTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRW
    WLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVGNSGN
    LRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGD
    NVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPA
    FIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY
    WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • ST3GAL1
  • Full Name
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 1
  • Introduction
  • The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet.
  • Alternative Names
  • ST3GAL1; ST3O; SIAT4A; SIATFL; ST3GalA; ST3GalIA; Gal-NAc6S; ST3GalA.1; ST3GalIA,1; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; SIAT4-A; ST3GalI; alpha 2,3-ST 1; beta-galactoside alpha-2,3-sialyltransferase 1; monosialoganglioside sialyltransferase; sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase); sialyltransferase 4A (beta-galactoside alpha-2,3-sialyltransferase); sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase); ST3 beta-galactoside alpha-2,3-sialyltransferase 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us