Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ST6GALNAC4 (ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4) Expressed in NS0 for Antibody Discovery, Partial (36-302aa) (CAT#: MPX0831K)

This product is a 31 kDa Human ST6GALNAC4 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST6GALNAC4
  • Protein Length
  • Partial (36-302aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 31 kDa
  • TMD
  • 1
  • Sequence
  • TCLDHHFPTGSRPTV
    PGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECV
    FRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMV
    WGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDET
    GKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYH
    YFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWR
    TE

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain at 5 μg per lane.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris and NaCl.

Target

  • Target Protein
  • ST6GALNAC4
  • Full Name
  • ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
  • Introduction
  • The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • ST6GALNAC4; IV; SIAT3C; SIAT7D; SIAT3-C; SIAT7-D; ST6GalNAc; ST6GALNACIV; alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase; NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2, 6-sialyltransferase alpha2,6-sialyltransferase; NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase IV; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4; ST6 GalNAc alpha-2,6-sialyltransferase 4; ST6 neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 4; ST6GalNAc IV; sialyltransferase 3C; sialyltransferase 7D ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase); ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us