Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ST8SIA2 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2) Expressed in NS0 for Antibody Discovery, Partial (24-375aa) (CAT#: MPX0582K)

This product is a 41 kDa Human ST8SIA2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST8SIA2
  • Protein Length
  • Partial (24-375aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 41 kDa
  • TMD
  • 1
  • Sequence
  • DISEIEEEIGNSGGRGTIRSAVNSLHS
    KSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI
    LKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLK
    NKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKT
    DLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKE
    RVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMY
    TLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPL
    EFKALKSLHEQGALKLTVGQCDGAT

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris and NaCl.

Target

  • Target Protein
  • ST8SIA2
  • Full Name
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
  • Introduction
  • The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.
  • Alternative Names
  • ST8SIA2; STX; SIAT8B; SIAT8-B; HsT19690; ST8SiaII; ST8SIA-II; alpha-2,8-sialyltransferase 8B; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 2; alpha-2,8-sialyltransferase 8B 1
    sialyltransferase 8 (alpha-2, 8-sialytransferase) B; sialyltransferase 8B; sialyltransferase St8Sia II; sialyltransferase X; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us