Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TACSTD2 (Tumor associated calcium signal transducer 2) Expressed in Mammalian cell expression system with hIgG1 FC tag at the C-terminus for Antibody Discovery, Partial (27-274aa) (CAT#: MPX4110K)

This product is a 56.8 kDa Human TACSTD2 membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TACSTD2
  • Protein Length
  • Partial (27-274aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 56.8 kDa
  • TMD
  • 1
  • Sequence
  • HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • hIgG1 FC tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TACSTD2
  • Full Name
  • Tumor associated calcium signal transducer 2
  • Introduction
  • This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
  • Alternative Names
  • TACSTD2; EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1; 40kD glycoprotein, identified by monoclonal antibody GA733; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; epithelial glycoprotein-1; gastrointestinal tumor-associated antigen GA7331; membrane component, chromosome 1, surface marker 1; pancreatic carcinoma marker protein GA733-1; pancreatic carcinoma marker protein GA7331; trophoblast cell surface antigen 2; truncated TACSTD2; Tumor associated calcium signal transducer 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us