Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TLCD3A (TLC domain containing 3A) Full Length (CAT#: MPC4421K) Made to Order

This product is a made-to-order Human TLCD3A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TLCD3A
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 7
  • Sequence
  • MLLTLAGGALFFPGLFALCTWALRRSQPGWSRTDCVMISTRLVSSVHAVL
    ATGSGIVIIRSCDDVITGRHWLAREYVWFLIPYMIYDSYAMYLCEWCRTR
    DQNRAPSLTLRNFLSRNRLMITHHAVILFVLVPVAQRLRGDLGDFFVGCI
    FTAELSTPFVSLGRVLIQLKQQHTLLYKVNGILTLATFLSCRILLFPFMY
    WSYGRQQGLSLLQVPFSIPFYCNVANAFLVAPQIYWFCLLCRKAVRLFDT
    PQAKKDG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • TLCD3A
  • Full Name
  • TLC domain containing 3A
  • Introduction
  • The protein encoded by this gene is a membrane-associated protein that promotes lung carcinogenesis. The encoded protein may be involved in amino acid transport and glutathione metabolism since it can interact with a solute carrier family member (SLC3A2) and an isoform of gamma-glutamyltranspeptidase-like 3. An alternatively spliced variant encoding a protein that lacks a 32 aa internal segment showed the opposite effect, inhibiting lung cancer cell growth. Knockdown of this gene also inhibited lung carcinogenesis and tumor cell growth. Several transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • TLCD3A; CT120; FAM57A; TLC domain-containing protein 3A; family with sequence similarity 57 member A; membrane protein expressed in epithelial-like lung adenocarcinoma; protein FAM57A; TLC domain containing 3A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us