Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TM2D2 (TM2 domain containing 2) Full Length (CAT#: MPC3174K) Made to Order

This product is a made-to-order Human TM2D2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TM2D2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 2
  • Sequence
  • MVLGGCPVSYLLLCGQAALLLGNLLLLHCVSRSHSQNATAEPELTSAGAA
    QPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNATASQELG
    YGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTGHYF
    ITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITG
    GLMPSDGSNWCTVY

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • TM2D2
  • Full Name
  • TM2 domain containing 2
  • Introduction
  • The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. This gene has multiple alternatively spliced transcript variants which encode two different isoforms.
  • Alternative Names
  • TM2D2; BLP1; TM2 domain-containing protein 2; BBP-like protein 1; beta-amyloid-binding protein-like protein 1; TM2 domain containing 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us