Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TM2D3 (TM2 domain containing 3) Full Length (CAT#: MPC1733K) Made to Order

This product is a 27.1 kDa Human TM2D3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TM2D3
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 27.1 kDa
  • TMD
  • 2
  • Sequence
  • MAGGVLPLRGLRALCRVLLFLSQFCILSGGEQSQALAQSIKDPGPTRTFT
    VVPRAAESTEIPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDC
    AVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSCP
    RQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFG
    ADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TM2D3
  • Full Name
  • TM2 domain containing 3
  • Introduction
  • The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. Several alternatively spliced transcript variants of this gene are described but the full length nature of some variants has not been determined. Multiple polyadenylation sites have been found in this gene.
  • Alternative Names
  • TM2D3; BLP2; TM2 domain-containing protein 3; BBP-like protein 2; almondex homolog; beta-amyloid-binding protein-like protein 2; TM2 domain containing 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us