Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM158 (Transmembrane protein 158) Full Length (CAT#: MPC1610K) Made to Order

This product is a 30.4 kDa Human TMEM158 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM158
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 30.4 kDa
  • TMD
  • 2
  • Sequence
  • MLPLLAALLAAACPLPPVRGGAADAPGLLGVPSNASVNASSADEPIAPRL
    LASAAPGPPERPGPEEAAAAAAPCNISVQRQMLSSLLVRWGRPRGFQCDL
    LLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVR
    GRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCL
    DFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAG
    FLPNGMEQRRTTASTTAATPAAVPAGTTAAAAAAAAAAAAAAVTSGVATK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMEM158
  • Full Name
  • Transmembrane protein 158
  • Introduction
  • Constitutive activation of the Ras pathway triggers an irreversible proliferation arrest reminiscent of replicative senescence. Transcription of this gene is upregulated in response to activation of the Ras pathway, but not under other conditions that induce senescence. The encoded protein is similar to a rat cell surface receptor proposed to function in a neuronal survival pathway. An allelic polymorphism in this gene results in both functional and non-functional (frameshifted) alleles; the reference genome represents the functional allele.
  • Alternative Names
  • TMEM158; BBP; RIS1; p40BBP; 40 kDa BINP-binding protein; BINP receptor; Ras induced senescence 1; brain injury-derived neurotrophic peptide (BINP) binding protein; brain specific binding protein; Transmembrane protein 158

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us