Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMED1 (Transmembrane p24 trafficking protein 1) Full Length (CAT#: MPC1258K) Made to Order

This product is a 25.2 kDa Human TMED1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMED1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 25.2 kDa
  • TMD
  • 1
  • Sequence
  • MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSA
    PANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEA
    GDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLDVK
    MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVN
    VAVLLLVAVLQVCTLKRFFQDKRPVPT

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMED1
  • Full Name
  • Transmembrane p24 trafficking protein 1
  • Introduction
  • This gene belongs to the TMED (transmembrane emp24 domain-containing) protein family, which is involved in the vesicular trafficking of proteins. The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1) and may play a role in innate immunity. This protein lacks any similarity to other interleukin 1 ligands. Alternative splicing results in multiple transcript variants of this gene.
  • Alternative Names
  • TMED1; Tp24; p24g1; Il1rl1l; IL1RL1LG; transmembrane emp24 domain-containing protein 1; IL1RL1-binding protein; interleukin 1 receptor-like 1 ligand; p24 family protein gamma-1; putative T1/ST2 receptor-binding protein; transmembrane emp24 protein transport domain containing 1; Transmembrane p24 trafficking protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us