Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEFF2 (Transmembrane protein with EGF like and two follistatin like domains 2) Full Length (CAT#: MPC1192K) Made to Order

This product is a 41.4 kDa Human TMEFF2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEFF2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 41.4 kDa
  • TMD
  • 1
  • Sequence
  • MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQT
    PTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYV
    PVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEG
    SGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGK
    SYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAEN
    ANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
    EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNR
    IHRQKQNTGHYSSDNTTRASTRLI

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMEFF2
  • Full Name
  • Transmembrane protein with EGF like and two follistatin like domains 2
  • Introduction
  • This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple soluble forms of this protein have been identified that arise from both an alternative splice variant and ectodomain shedding. Additionally, this gene has been found to be hypermethylated in multiple cancer types. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • TMEFF2; TR; HPP1; TPEF; TR-2; TENB2; CT120.2; tomoregulin-2; cancer/testis antigen family 120, member 2; hyperplastic polyposis protein 1; transmembrane protein TENB2; transmembrane protein with EGF-like and two follistatin-like domains; UNQ178/PRO204; Transmembrane protein with EGF like and two follistatin like domains 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us