Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM185A (Transmembrane protein 185A) Full Length (CAT#: MPC1592K) Made to Order

This product is a 40.6 kDa Human TMEM185A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM185A
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 40.6 kDa
  • TMD
  • 7
  • Sequence
  • MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLW
    KLMVIVGASVGTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVL
    VCDRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNI
    LQFIFIALRLDKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSM
    DVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNAFSSIPIFVPL
    WLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH
    HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMEM185A
  • Full Name
  • Transmembrane protein 185A
  • Introduction
  • The protein encoded by this gene is predicted to be a transmembrane protein. This gene is best known for localizing to the CpG island of the fragile site FRAXF. The 5' untranslated region of this gene contains a CGG trinucleotide repeat sequence that normally consists of 7-40 tandem CGG repeats but which can expand to greater than 300 repeats. Methylation of the CpG island leads to transcriptional silencing of this gene, but neither the silencing nor an expanded repeat region appear to manifest itself in a clear phenotypic manner. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on the X chromosome.
  • Alternative Names
  • TMEM185A; ee3; FRAXF; FAM11A; CXorf13; family with sequence similarity 11, member A; fragile site, folic acid type, rare, fra(X)(q28) F; Transmembrane protein 185A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us