Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM37 (Transmembrane protein 37) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2170K)

This product is a Human TMEM37 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM37
  • Protein Length
  • Full Length
  • Protein Class
  • Ion channel, Transport
  • TMD
  • 4
  • Sequence
  • MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TMEM37
  • Full Name
  • Transmembrane protein 37
  • Alternative Names
  • TMEM37; PR; PR1; voltage-dependent calcium channel gamma-like subunit; neuronal voltage-gated calcium channel gamma-like subunit; voltage-dependent calcium channel gamma subunit-like protein; Transmembrane protein 37

Case Studies

Customer reviews and Q&As    

Related Products
  • CAT
  • Product Name
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us