Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMIGD2 (Transmembrane and immunoglobulin domain containing 2) Expressed in HEK293 for Antibody Discovery, Partial (23-150aa) (CAT#: MPX0190K)

This product is a 15 kDa Human TMIGD2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMIGD2
  • Protein Length
  • Partial (23-150aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 15 kDa
  • TMD
  • 1
  • Sequence
  • LSVQQGPNLLQVRQGSQATLVCQVDQAT
    AWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLD
    PVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TMIGD2
  • Full Name
  • Transmembrane and immunoglobulin domain containing 2
  • Alternative Names
  • TMIGD2; CD28H; IGPR1; IGPR-1; transmembrane and immunoglobulin domain-containing protein 2; CD28 homolog; CD28 homologue; immunoglobulin and proline-rich receptor 1; immunoglobulin-containing and proline-rich receptor 1; transmembrane and immunoglobulin domain-containing protein 2 variant 2; transmembrane and immunoglobulin domain-containing protein 2 variant 3; Transmembrane and immunoglobulin domain containing 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us