Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMX1 (Thioredoxin related transmembrane protein 1) Full Length (CAT#: MPC1233K) Made to Order

This product is a 31.7 kDa Human TMX1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMX1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 31.7 kDa
  • TMD
  • 1
  • Sequence
  • MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIE
    FYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIITAL
    PTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMS
    SMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMI
    FVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEE
    AESKEGTNKDFPQNAIRQRSLGPSLATDKS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMX1
  • Full Name
  • Thioredoxin related transmembrane protein 1
  • Introduction
  • This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides.
  • Alternative Names
  • TMX1; TMX; TXNDC; PDIA11; TXNDC1; thioredoxin-related transmembrane protein 1; protein disulfide isomerase family A, member 11; thioredoxin domain containing 1; thioredoxin domain-containing protein 1; transmembrane Trx-related protein; Thioredoxin related transmembrane protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us