Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF14 (TNF receptor superfamily member 14) Expressed in NS0 for Antibody Discovery, Partial (37-202aa, Ser108Thr; Ala140Arg) (CAT#: MPX0540K)

This product is a 45 kDa Human TNFRSF14 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF14
  • Protein Length
  • Partial (37-202aa, Ser108Thr; Ala140Arg)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 45 kDa
  • TMD
  • 1
  • Sequence
  • PALPSCKEDEYPVG
    SECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
    PAMGLRATRNCSRTENAVCGCSPGHFCIVQDGDHCAACRRYATSSPGQRV
    QKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSH
    WV

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TNFRSF14
  • Full Name
  • TNF receptor superfamily member 14
  • Introduction
  • This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • TNFRSF14; TR2; ATAR; HVEA; HVEM; CD270; LIGHTR; tumor necrosis factor receptor superfamily member 14; CD40-like protein; herpes virus entry mediator A; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor-like gene2; TNF receptor superfamily member 14

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us