Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFSF4 (TNF superfamily member 4) expressed in Hi-5 insect for Antibody Discovery (CAT#: MP0028Q)

This product is a 15 kDa Human TNFSF4 membrane protein expressed in Hi-5 insect. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFSF4
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 15 kDa
  • TMD
  • 1
  • Sequence
  • QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Product Description

  • Expression Systems
  • Hi-5 insect
  • Tag
  • Tag Free
  • Purity
  • >95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2

Target

  • Target Protein
  • TNFSF4
  • Full Name
  • TNF superfamily member 4
  • Introduction
  • This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CD134L; CD252; GP34; OX-40L; TNLG2B; TXGP1; CD134 ligand; OX40 antigen ligand; tax-transcriptionally activated glycoprotein 1 (34kD); tumor necrosis factor (ligand) superfamily member 4; tumor necrosis factor ligand 2B; tumor necrosis factor superfamily member 4; Glycoprotein Gp34; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us