Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TRARG1 (Trafficking regulator of GLUT4 (SLC2A4) 1) Full Length (CAT#: MPC2009K) Made to Order

This product is a 19.2 kDa Human TRARG1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TRARG1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 19.2 kDa
  • TMD
  • 2
  • Sequence
  • MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGP
    LDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEA
    PRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVDGARRLGRLAR
    LLSITLIIMGIVIIMVAVTVNFTVQKK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TRARG1
  • Full Name
  • Trafficking regulator of GLUT4 (SLC2A4) 1
  • Alternative Names
  • TRARG1; BEC-1; DSPB1; LOST1; TUSC5; IFITMD3; trafficking regulator of GLUT4 1; brain endothelial cell derived gene-1; dispanin subfamily B member 1; interferon induced transmembrane protein domain containing 3; interferon-induced transmembrane domain-containing protein D3; located at seventeen p thirteen point three 1; protein located at seventeen-p-thirteen point three 1; tumor suppressor candidate 5; Trafficking regulator of GLUT4 (SLC2A4) 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us