Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TRARG1 (Trafficking regulator of GLUT4 (SLC2A4) 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1277K)

This product is a Human TRARG1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TRARG1
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TRARG1
  • Full Name
  • Trafficking regulator of GLUT4 (SLC2A4) 1
  • Alternative Names
  • TRARG1; BEC-1; DSPB1; LOST1; TUSC5; IFITMD3; trafficking regulator of GLUT4 1; brain endothelial cell derived gene-1; dispanin subfamily B member 1; interferon induced transmembrane protein domain containing 3; interferon-induced transmembrane domain-containing protein D3; located at seventeen p thirteen point three 1; protein located at seventeen-p-thirteen point three 1; tumor suppressor candidate 5; Trafficking regulator of GLUT4 (SLC2A4) 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us