Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TRPA1 (Transient receptor potential cation channel subfamily A member 1) for Antibody Discovery (CAT#: MP1404J)

This product is a 35.2 kDa Human TRPA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TRPA1
  • Protein Length
  • Partial (957-1119aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 35.2 kDa
  • Sequence
  • IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-6xHis-SUMO
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TRPA1
  • Full Name
  • Transient receptor potential cation channel subfamily A member 1
  • Introduction
  • The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control.
  • Alternative Names
  • ANKTM 1; ANKTM1; Ankyrin-like with transmembrane domains protein 1; Transformation sensitive protein p120; Transformation-sensitive protein p120; Transient receptor potential cation channel subfamily A member 1; TRPA 1; Trpa1; TRPA1_HUMAN

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us