Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TSPAN4 (Tetraspanin 4) Full Length (CAT#: MPC1815K) Made to Order

This product is a 26.1 kDa Human TSPAN4 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TSPAN4
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 26.1 kDa
  • TMD
  • 4
  • Sequence
  • MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPS
    LSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATI
    AILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGV
    SNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQE
    NLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TSPAN4
  • Full Name
  • Tetraspanin 4
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • TSPAN4; NAG2; NAG-2; TM4SF7; TSPAN-4; TETRASPAN; tetraspanin-4; novel antigen 2; tetraspan TM4SF; transmembrane 4 superfamily member 7; Tetraspanin 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us