Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TSPAN9 (Tetraspanin 9) for Antibody Discovery (CAT#: MP1453X)

This product is a 43.6 kDa Human TSPAN9 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TSPAN9
  • Protein Length
  • Full-length
  • Molecular Weight
  • 43.6 kDa
  • TMD
  • 4
  • Sequence
  • MWGRPTFEQSCPALVPWPGFLVRSFSRLRRNPQSADSGADTSGRRDSADKCCSCTVGPGASCVFCCGWGGWVGLCLSMQFLIFVNINSKSLVHWEMCNLPENLFCFWSTSGVASGPRAFATVLPPAPTSSVCLQSLIYRSPRCLLYSLCAWPFCYLA

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Protein Format
  • Liposome
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • TSPAN9
  • Full Name
  • Tetraspanin 9
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Alternatively spliced transcripts encoding the same protein have been identified.
  • Alternative Names
  • NET5; NET-5; PP1057

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us