Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UQCR10 (Ubiquinol-cytochrome c reductase, complex III subunit X) Full Length (CAT#: MPC2130K) Made to Order

This product is a 7.3 kDa Human UQCR10 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UQCR10
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 7.3 kDa
  • TMD
  • 1
  • Sequence
  • MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEG
    KLWKHIKHKYENK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • UQCR10
  • Full Name
  • Ubiquinol-cytochrome c reductase, complex III subunit X
  • Introduction
  • UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.
  • Alternative Names
  • UQCR10; QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2; cytochrome b-c1 complex subunit 9; cytochrome C1, nonheme 7kDa protein; cytochrome c1 non-heme 7 kDa protein; ubiquinol-cytochrome c reductase complex (7.2 kD); ubiquinol-cytochrome c reductase complex 7.2 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa; Ubiquinol-cytochrome c reductase, complex III subunit X

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us