Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VAMP7 (Vesicle associated membrane protein 7) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (2-186aa) (CAT#: MPX4509K)

This product is a 25.0kDa Human VAMP7 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VAMP7
  • Protein Length
  • Partial (2-186aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 25.0kDa
  • TMD
  • 1
  • Sequence
  • AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKN

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • VAMP7
  • Full Name
  • Vesicle associated membrane protein 7
  • Introduction
  • This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • VAMP7; SYBL1; TIVAMP; VAMP-7; TI-VAMP; vesicle-associated membrane protein 7; synaptobrevin-like 1; synaptobrevin-like protein 1; tetanus neurotoxin-insensitive VAMP; tetanus-insensitive VAMP; Vesicle associated membrane protein 7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us