Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ZDHHC7 (Zinc finger DHHC-type palmitoyltransferase 7) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2417K)

This product is a Human ZDHHC7 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ZDHHC7
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 4
  • Sequence
  • MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ZDHHC7
  • Full Name
  • Zinc finger DHHC-type palmitoyltransferase 7
  • Alternative Names
  • ZDHHC7; DHHC7; SERZ1; SERZ-B; ZNF370; palmitoyltransferase ZDHHC7; DHHC-7; Sertoli cell gene with zinc finger domain-I(2); Sertoli cell gene with zinc finger domain-beta; acyltransferase ZDHHC7; zinc finger DHHC domain-containing protein 7; zinc finger DHHC-type containing 7; zinc finger protein 370; zinc finger, DHHC domain containing 7; Zinc finger DHHC-type palmitoyltransferase 7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us