Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ZDHHC9 (Zinc finger DHHC-type palmitoyltransferase 9) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2492K)

This product is a Human ZDHHC9 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ZDHHC9
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 4
  • Sequence
  • MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ZDHHC9
  • Full Name
  • Zinc finger DHHC-type palmitoyltransferase 9
  • Introduction
  • This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.
  • Alternative Names
  • ZDHHC9; CGI89; DHHC9; MMSA1; MRXSZ; ZNF379; ZNF380; CXorf11; ZDHHC10; palmitoyltransferase ZDHHC9; Asp-His-His-Cys domain containing protein 9; antigen MMSA-1; zinc finger DHHC-type containing 9; zinc finger protein 379; zinc finger protein 380; zinc finger, DHHC domain containing 10; Zinc finger DHHC-type palmitoyltransferase 9

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us