Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Cldn22 (Claudin 22) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2222K)

This product is a Mouse Cldn22 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Cldn22
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 4
  • Sequence
  • MGLVFRTATQAAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWSPAPAASSHYAVAGPRDHQQHLELKQANPEI

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Cldn22
  • Full Name
  • Claudin 22
  • Introduction
  • This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and overlaps the 3' UTR of the Wwc2 gene (GeneID: 52357) on the opposite strand.
  • Alternative Names
  • Cldn22; 2210404A22Rik; 5330431C14Rik; 9530051B05Rik; claudin-22; Claudin 22

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us