Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Clic4 (Chloride intracellular channel 4 (mitochondrial)) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1489K)

This product is a Mouse Clic4 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Clic4
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Ion channel, Transport
  • TMD
  • 1
  • Sequence
  • ALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Clic4
  • Full Name
  • Chloride intracellular channel 4 (mitochondrial)
  • Alternative Names
  • Clic4; mc3s; mtCL; TU-74; mc3s5; D0Jmb3; mtCLIC; chloride intracellular channel protein 4; mc3s5/mtCLIC; Chloride intracellular channel 4 (mitochondrial)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us