Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Fam162a (Family with sequence similarity 162, member A) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1202K)

This product is a Mouse Fam162a membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Fam162a
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MWSLGGLRLAAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVPLHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMVIEGKKAAKRHESLTSLNLERKARLREEAAMKAKTD

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Fam162a
  • Full Name
  • Family with sequence similarity 162, member A
  • Alternative Names
  • Fam162a; HGTD-P; 2310056P07Rik; protein FAM162A; E2-induced gene 5 protein homolog; growth and transformation-dependent protein; Family with sequence similarity 162, member A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us