Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Kcne1 (Potassium voltage-gated channel, Isk-related subfamily, member 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3693K)

This product is a Mouse Kcne1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Kcne1
  • Protein Length
  • Full Length
  • Protein Class
  • Ion channel, Transport
  • TMD
  • 1
  • Sequence
  • MSLPNSTTVLPFLARLWQETAEQGGNVSGLARKSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKAVFQARVLESFRACYVIENQAAVEQPATHLPELKPLS

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Kcne1
  • Full Name
  • Potassium voltage-gated channel, Isk-related subfamily, member 1
  • Alternative Names
  • Kcne1; I; Mi; Isk; MinK; nmf19; nmf190; IKs producing slow voltage-gated potassium channel subunit beta Mink; delayed rectifier potassium channel subunit IsK; minimal potassium channel; Potassium voltage-gated channel, Isk-related subfamily, member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us