Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Kcnj9 (Potassium inwardly-rectifying channel, subfamily J, member 9) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1780K)

This product is a Mouse Kcnj9 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Kcnj9
  • Protein Length
  • Full Length
  • Protein Class
  • Ion channel, Transport
  • TMD
  • 2
  • Sequence
  • MAQENAAFSPGSEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGAGDGADKEHNGCLPPPESESKV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Kcnj9
  • Full Name
  • Potassium inwardly-rectifying channel, subfamily J, member 9
  • Alternative Names
  • Kcnj9; Gir; Kir3; Girk3; Kir3.3; mbGIRK3; 1700085N21Rik; G protein-activated inward rectifier potassium channel 3; GIRK-3; inward rectifier K(+) channel Kir3.3; inwardly rectifier K(+) channel Kir3.3; potassium channel, inwardly rectifying subfamily J member 9; Potassium inwardly-rectifying channel, subfamily J, member 9

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us