Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Skint11 (Selection and upkeep of intraepithelial T cells 11) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1664K)

This product is a Mouse Skint11 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Skint11
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • LDIQINTQIPDTEEGVLVECTAESLFPPAEMTWRDSKGNIIPPSSTFDSQDRAGLLCLKSTILLKNRTEGPITCSIYNKTTNQEKRRSIILSDVLFRPQYMSLMSNNLLYLGIYLIFILFLNFLKGILFCLTKRLVHFRKRMIKIKKVWSNKTRACCPLIWEFLEIVLFIAFLPLYLMFRIRVFTLDEAHILYNNWLWKVCKTLIAMMILFTVLILFLLWTLNRYGKMPCLSSMNIDVSTHDAEQNSSKSAKFQENYDVAGQMILETYEETIFCQHQESCEEYNYDPLLLSSLDALGTCEDEKFSQHQESFEEDEDLQSFSDFKIELYSKLGNLTH

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Skint11
  • Full Name
  • Selection and upkeep of intraepithelial T cells 11
  • Alternative Names
  • Skint11; Gm569; A630098G03Rik; skint 11; Selection and upkeep of intraepithelial T cells 11

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us