Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Nosema ceranae (strain BRL01) AQP (Nosema ceranae Aquaporin(AQP)) for Antibody Discovery (CAT#: MP1428J)

This product is a 26.9 kDa Nosema ceranae (strain BRL01) AQP membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Nosema ceranae (strain BRL01)
  • Target Protein
  • AQP
  • Protein Length
  • Full-length
  • Protein Class
  • Aquaporin
  • Molecular Weight
  • 26.9 kDa
  • TMD
  • 6
  • Sequence
  • MTRKWIKKLQSYIGEFFASFIFGFAVYTSIIGSAQTGQSAGPIIVALTIALSGVAIIYSFCDITVAHFNPAITFSAMCFRRLPFFGGIFIIIFQVAGFIIAGLASVAVLPGKYKNKLEIARPKRVADNVSRGRIFGTEFFLTAILVYVAFAVGVNPYTPPKDEHGDQLDPDEGLTEGRKITAPLAIGFTLGFCALLGIASSGGAFNPGIVLSPMILTGTWDFWWVYLLGQFSGGLLGGGLQRFLLYKIF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • AQP
  • Full Name
  • Nosema ceranae Aquaporin(AQP)
  • Introduction
  • Water channel required to facilitate the transport of water across membranes. Involved in osmotolerance (By similarity).
  • Alternative Names
  • AQP; NCER_102220Aquaporin

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us