Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Rat Atf4 (Activating transcription factor 4) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0911K)

This product is a Rat Atf4 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Rat
  • Target Protein
  • Atf4
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 45.6 kDa
  • Sequence
  • MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Atf4
  • Full Name
  • Activating transcription factor 4
  • Introduction
  • binds GABA(B) receptors; may play a role in regulation of activity dependent gene expression.
  • Alternative Names
  • Atf4; cyclic AMP-dependent transcription factor ATF-4; activating transcription factor 4 (tax-responsive enhancer element B67); activating transcription factor ATF-4; cAMP-dependent transcription factor ATF-4; rATF-4; Activating transcription factor 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us