Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein SARS2 orf7b (ORF7b protein) Expressed in cell-free expression system, Full Length (CAT#: MPX0375K)

This product is a 5.11 kDa SARS2 orf7b membrane protein expressed in cell-free expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • SARS2
  • Target Protein
  • orf7b
  • Protein Length
  • Full length
  • Protein Class
  • Host-virus interaction
  • Molecular Weight
  • 5.11 kDa
  • Sequence
  • MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA

Product Description

  • Expression Systems
  • Cell-free expression system

Target

  • Target Protein
  • orf7b
  • Full Name
  • ORF7b protein
  • Introduction
  • Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF7b encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF7b protein is thought to localize to the Golgi compartment.
  • Alternative Names
  • orf7b; Accessory protein 7b; NS7b; ORF7b protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us