Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Vaccinia virus VACWR074 (Temporal expression: late) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0931K)

This product is a Vaccinia virus VACWR074 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Vaccinia virus
  • Target Protein
  • VACWR074
  • Protein Length
  • Full Length
  • Protein Class
  • Virus
  • Molecular Weight
  • 24.6kDa
  • TMD
  • 2
  • Sequence
  • VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • VACWR074
  • Full Name
  • Temporal expression: late
  • Alternative Names
  • VACWR074; Hypothetical protein; Protein I5; Protein VP13K; Temporal expression: late

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us