Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Yersinia enterocolitica yopE (Outer membrane virulence protein YopE) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0928K)

This product is a Yersinia enterocolitica yopE membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Yersinia enterocolitica
  • Target Protein
  • yopE
  • Protein Length
  • Full Length
  • Protein Class
  • Virulence
  • Molecular Weight
  • 26.9kDa
  • Sequence
  • MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • yopE
  • Full Name
  • Outer membrane virulence protein YopE
  • Alternative Names
  • yopE; type III secretion system effector GTPase activator YopE; Outer membrane virulence protein YopE

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us