Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human CLDN2 Protein (Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW93)

Recombinant full-length human CLDN2 protein reconstituted in a nanodisc membrane-mimetic system for biochemical, binding, and assay development applications.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN2
  • Protein Length
  • Full-length
  • Protein Class
  • Tight Junction Protein
  • Molecular Weight
  • 26 kDa
  • Sequence
  • MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV

Product Description

  • Expression Systems
  • HEK293 cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • CLDN2
  • Full Name
  • claudin 2
  • Introduction
  • Claudin-2 (CLDN2) is a full-length human claudin. Claudins function as major constituents of the tight junction complexes that regulate the permeability of Forms paracellular channels: polymerizes in tight junction strands with cation- and water-selective channels through the strands, conveying epithelial permeability in a process known as paracellular tight junction permeability. In intestinal epithelium, allows for sodium and water fluxes from the peritoneal side to the lumen of the intestine to regulate nutrient absorption and clear enteric pathogens as part of mucosal immune response. In kidney, allows passive sodium and calcium reabsorption across proximal tubules from the lumen back to the bloodstream. The protein is supplied in an MSP-free, copolymer-stabilized native-lipid nanodisc. The preparation uses 2-step purification.

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us