Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of CYSLTR2
CysLTR2 is encoded by the CysLTR2 gene and is a receptor for cysteinyl leukotrienes. It belongs to the G-protein-coupled receptor (GPCR) family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. It seems to play a major role in endocrine and cardiovascular systems.
| Basic Information of CysLTR2 | |
| Protein Name | Cysteinyl leukotriene receptor 2 |
| Gene Name | CYSLTR2 |
| Aliases | HG57, CYSLT2, GPCR21, HPN321, CYSLT2R, KPG_011, hGPCR21, PSEC0146 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9NS75 |
| Transmembrane Times | 7 |
| Length (aa) | 346 |
| Sequence |
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKS TSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAM VHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGC LLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCK DRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV |
Function of CYSLTR2 Membrane Protein
The CysLT-induced activation of CysLTR2 induces many of the same in vitro responses of cells involved in allergic reactions as well as the in vivo allergic responses in animal models as that induced by CysLT-induced CysLTR1. Via a G-protein, the response is mediated that activates a phosphatidylinositol-calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veins and might also have an indirect role in the relaxation of the pulmonary vascular endothelium. CysLTR2 is involved in lipid sensing and inflammation. CysLTR2 is associated with diseases such as melanoma, uveal, and adenoid hypertrophy.
Fig.1 Structure of CYSLTR2 membrane protein.
Application of CYSLTR2 Membrane Protein in Literature
In this study, it was found that CysLT2 receptors mediate LTC4-induced bronchoconstriction and air-trapping in S-hexyl GSH-treated guinea pigs. It is therefore believed that CysLT2 receptors contribute to asthmatic response involving air-trapping.
Authors in this group apply the fragment-based mapping algorithm, FTMap, on the conformations of CYSLTR2 and uncover five non-orthosteric sites on the CYSLTR2.
The results of this article reveal that endothelium-targeted overexpression of CysLT2R aggravates myocardial I/R injury by increasing endothelial permeability and exacerbating inflammatory gene expression, leading to accelerated left ventricular remodeling, induction of peri-infarct zone cellular apoptosis, and impaired cardiac performance.
The results of this article suggest CYSLTR2 as an oncogene of uveal melanoma and emphasize the critical role of Gαq signaling in uveal melanoma pathogenesis.
CYSLTR2 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CYSLTR2 antibody development services.
Through years of accumulation and improvement, Creative Biolabs has successfully produced many functional membrane proteins for our customers. We are pleased to tailor one-stop, custom-oriented service packages regarding a variety of membrane protein targets. For more detail about special membrane protein needs of your projects or research, please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
