Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD4 (Frizzled class receptor 4) Expressed in NS0 for Antibody Discovery, Partial (37-180aa) (CAT#: MPX0026K)

This product is a 42.8 kDa Human FZD4 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD4
  • Protein Length
  • Partial (37-180aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 42.8 kDa
  • TMD
  • 7
  • Sequence
  • FGDEEERRCDPIRI
    SMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCS
    VYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPP
    QNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 400 μg/mL in PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FZD4
  • Full Name
  • Frizzled class receptor 4
  • Introduction
  • This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
  • Alternative Names
  • Fz4; EVR1; FEVR; Fz-4; FzE4; GPCR; hFz4; CD344; FZD4S; frizzled-4; WNT receptor frizzled-4; frizzled 4, seven transmembrane spanning receptor; frizzled family receptor 4; frizzled homolog 4; FZD4; Frizzled class receptor 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us