Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HTR1D (5-hydroxytryptamine receptor 1D) Expressed in Mammalian cell expression system with hIgG1 FC tag at the C-terminus for Antibody Discovery, Partial (1-38aa) (CAT#: MPX4193K)

This product is a 33.1 kDa Human HTR1D membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HTR1D
  • Protein Length
  • Partial (1-38aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 33.1 kDa
  • TMD
  • 7
  • Sequence
  • MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • hIgG1 FC tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • HTR1D
  • Full Name
  • 5-hydroxytryptamine receptor 1D
  • Alternative Names
  • HTRL; RDC4; HT1DA; 5-HT1D; HTR1DA; 5-HT-1D; 5-HT-1D-alpha; 5-hydroxytryptamine (serotonin) receptor 1D, G protein-coupled; serotonin 1D alpha receptor; serotonin receptor 1D; HTR1D; 5-hydroxytryptamine receptor 1D

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us