Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein E. coli CLIC4 (Chloride intracellular channel 4) for Antibody Discovery (CAT#: MP0244X)

This product is a 30.9 kDa E. coli CLIC4 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • E. coli
  • Target Protein
  • CLIC4
  • Protein Length
  • Full-length
  • Molecular Weight
  • 30.9 kDa
  • TMD
  • 1
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Product Description

  • Application
  • SDS-PAGE
  • Expression Systems
  • E. coli
  • Tag
  • Escherichia coli
  • Purification
  • Conventional Chromatography
  • Purity
  • > 95% by SDS-PAGE
  • Buffer
  • 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 10% glycerol)

Target

  • Target Protein
  • CLIC4
  • Full Name
  • Chloride intracellular channel 4
  • Introduction
  • Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells)
  • Alternative Names
  • CLIC4L; DKFZp566G223; FLJ38640; H1; MTCLIC; huH1; p64H1; OTTHUMP00000003380; chloride intracellular channel 4 like

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us