Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ACKR3 (Atypical chemokine receptor 3) Expressed in Wheat germ, Full Length (CAT#: MPX0015K)

This product is a 67.9 kDa Human ACKR3 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ACKR3
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 67.9 kDa
  • TMD
  • 7
  • Sequence
  • MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

Product Description

  • Application
  • ELISA; WB
  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at N-Terminus
  • Protein Format
  • Soluble
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • ACKR3
  • Full Name
  • Atypical chemokine receptor 3
  • Introduction
  • This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.
  • Alternative Names
  • RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159; atypical chemokine receptor 3; C-X-C chemokine receptor type 7; G protein-coupled receptor; G-protein coupled receptor 159
    G-protein coupled receptor RDC1 homolog; chemokine (C-X-C motif) receptor 7; chemokine orphan receptor 1; ACKR3; Atypical chemokine receptor 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us