Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human AQP1 (Aquaporin 1, transcript variant 4) for Antibody Discovery (CAT#: MP1233J)

This product is a 17.1 kDa Human AQP1 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AQP1
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Ion Channels: Other, Transmembrane
  • Molecular Weight
  • 17.1 kDa
  • TMD
  • 6
  • Sequence
  • MQSGMGWNVLDFWLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAID
    YTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDL
    DADDINSRVEMKPK

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • AQP1
  • Full Name
  • Aquaporin 1
  • Introduction
  • This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement.
  • Alternative Names
  • CO; CHIP28; AQP-CHIP; Colton blood group antigen; aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1, Colton blood group antigen; aquaporin-CHIP; channel-like integral membrane protein, 28-kDa; urine water channel; water channel protein for red blood cells and kidney proximal tubule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us