Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ATP1B2 (ATPase Na+/K+ transporting subunit beta 2) Full Length (CAT#: MPC0410K) Made to Order

This product is a 33.3 kDa Human ATP1B2 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP1B2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 33.3 kDa
  • TMD
  • 1
  • Sequence
  • MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGF
    LTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDT
    ESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRAC
    QFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTC
    AGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLN
    VTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • ATP1B2
  • Full Name
  • ATPase Na+/K+ transporting subunit beta 2
  • Introduction
  • The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • AMOG; sodium/potassium-transporting ATPase subunit beta-2; ATPase, Na+/K+ transporting, beta 2 polypeptide; Na, K-ATPase beta-2 polypeptide; adhesion molecule in glia; adhesion molecule on glia; sodium pump subunit beta-2; sodium-potassium ATPase subunit beta 2 (non-catalytic); sodium/potassium-dependent ATPase beta-2 subunit; sodium/potassium-dependent ATPase subunit beta-2; sodium/potassium-transporting ATPase beta-2 chain; ATP1B2; ATPase Na+/K+ transporting subunit beta 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us