Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BCL2 (BCL2 apoptosis regulator) Expressed in E.coli for Antibody Discovery, Partial (2-211aa) (CAT#: MPX0279K)

This product is a 24.5 kDa Human BCL2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BCL2
  • Protein Length
  • Partial (2-211aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 24.5 kDa
  • TMD
  • 1
  • Sequence
  • AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFS
    SQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
    GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
    FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
    LYGPSMRPLFD

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Supplied as a 0.2 μm filtered solution in HEPES, KCl, DTT and Glycerol.

Target

  • Target Protein
  • BCL2
  • Full Name
  • BCL2 apoptosis regulator
  • Introduction
  • This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • BCL2; Bcl-2; PPP1R50; apoptosis regulator Bcl-2; B-cell CLL/lymphoma 2; protein phosphatase 1, regulatory subunit 50; BCL2 apoptosis regulator

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us