Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BCL2L10 (BCL2 like 10) Full Length (CAT#: MPC4204K) Made to Order

This product is a made-to-order Human BCL2L10 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BCL2L10
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLR
    SAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTL
    VTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLM
    GQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLW
    TRLL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • BCL2L10
  • Full Name
  • BCL2 like 10
  • Introduction
  • The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway.
  • Alternative Names
  • BCL2L10; Boo; Diva; BCL-B; bcl2-L-10; bcl-2-like protein 10; BCL2-like 10 (apoptosis facilitator); anti-apoptotic protein NrH; apoptosis regulator Bcl-B; death inducer binding to vBcl-2 and Apaf-1; BCL2 like 10

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us