Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF17 (TNF receptor superfamily member 17) Full Length (CAT#: MPC1670K) Made to Order

This product is a 20.1 kDa Human TNFRSF17 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF17
  • Protein Length
  • Full length
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 20.1 kDa
  • TMD
  • 1
  • Sequence
  • MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK
    GTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
    NIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAME
    EGATILVTTKTNDYCKSLPAALSATEIEKSISAR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TNFRSF17
  • Full Name
  • TNF receptor superfamily member 17
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
  • Alternative Names
  • TNFRSF17; BCM; BCMA; CD269; TNFRSF13A; tumor necrosis factor receptor superfamily member 17; B cell maturation antigen; B-cell maturation factor; B-cell maturation protein; TNF receptor superfamily member 17

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us